DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and HB51

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_195999.2 Gene:HB51 / 831723 AraportID:AT5G03790 Length:235 Species:Arabidopsis thaliana


Alignment Length:144 Identity:35/144 - (24%)
Similarity:60/144 - (41%) Gaps:43/144 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 KRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTR-- 354
            |:||      .::.|...||..||::..:....:.||:..|.|...|:.|||||||.:|:..:  
plant    77 KKKR------LTSGQLASLERSFQEEIKLDSDRKVKLSRELGLQPRQIAVWFQNRRARWKAKQLE 135

  Fly   355 ---ENLKS-----GQEKQP--------SAVPESGGVFKTSTPSGDGTPQEALDYSSDSCSSVDLS 403
               ::|:.     .:|||.        .|:....|:.|....:|                ::.:|
plant   136 QLYDSLRQEYDVVSREKQMLHDEVKKLRALLRDQGLIKKQISAG----------------TIKVS 184

  Fly   404 EQADEDDNIEINVV 417
               .|:|.:||:.|
plant   185 ---GEEDTVEISSV 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 17/52 (33%)
HB51NP_195999.2 Homeobox 77..130 CDD:395001 20/58 (34%)
HALZ 132..167 CDD:396657 5/34 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.