DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and HB-3

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_568309.2 Gene:HB-3 / 831367 AraportID:AT5G15150 Length:314 Species:Arabidopsis thaliana


Alignment Length:184 Identity:45/184 - (24%)
Similarity:72/184 - (39%) Gaps:55/184 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 LRFHQHQ---KQQHQQHHHHQHHPKHLHQQHKP--PPH-----------NSTTASALLAPLHSLT 234
            :.|.||.   :|.|:.:.||...|..|     |  |||           |.:.:...::..|.||
plant    22 MAFPQHGFMFQQLHEDNAHHLPSPTSL-----PSCPPHLFYGGGGNYMMNRSMSFTGVSDHHHLT 81

  Fly   235 SLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSWSR 299
            .            |:|....::............|.:|:|...|            .|:||    
plant    82 Q------------KSPTTTNNMNDQDQVGEEDNLSDDGSHMMLG------------EKKKR---- 118

  Fly   300 AVFSNLQR-KGLEIQFQQQKYITKPDRR-KLAARLNLTDAQVKVWFQNRRMKWR 351
               .||:: :.||..|:....: :|:|: :||..|.|...|:.:||||||.:|:
plant   119 ---LNLEQVRALEKSFELGNKL-EPERKMQLAKALGLQPRQIAIWFQNRRARWK 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 18/54 (33%)
HB-3NP_568309.2 HOX 115..168 CDD:197696 21/60 (35%)
HALZ 170..208 CDD:280364
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.