DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and ANL2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_567183.2 Gene:ANL2 / 828022 AraportID:AT4G00730 Length:802 Species:Arabidopsis thaliana


Alignment Length:188 Identity:48/188 - (25%)
Similarity:69/188 - (36%) Gaps:51/188 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 HNSTT------ASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAA---AAATSQNGA 273
            |.:.|      |.|..|...||.|..||:......|      |.:|...|...   ..|:.:|..
plant    29 HTAATNVLPGGAMAQAAAAASLFSPPLTKSVYASSG------LSLALEQPERGTNRGEASMRNNN 87

  Fly   274 HGHGGG-------------------NGQGNASAGSNGK---------RKRSWSRAVFSNLQRKGL 310
            :..|||                   :|..|.. |.:|:         ||:.:.|.....:|.  |
plant    88 NVGGGGDTFDGSVNRRSREEEHESRSGSDNVE-GISGEDQDAADKPPRKKRYHRHTPQQIQE--L 149

  Fly   311 EIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKW-----RHTRENLKSGQEK 363
            |..|::..:..:..|.:|:.||.|...|||.||||||.:.     ||....|:...:|
plant   150 ESMFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMKTQLERHENALLRQENDK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 19/57 (33%)
ANL2NP_567183.2 COG5576 99..209 CDD:227863 29/112 (26%)
Homeobox 137..190 CDD:278475 19/54 (35%)
START_ArGLABRA2_like 319..542 CDD:176884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.