DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and AT4G03250

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_192234.2 Gene:AT4G03250 / 827999 AraportID:AT4G03250 Length:507 Species:Arabidopsis thaliana


Alignment Length:128 Identity:39/128 - (30%)
Similarity:60/128 - (46%) Gaps:22/128 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 GNASA-GSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNR 346
            |.|:| |.....:.|..|.:.:.:|...||..:.:.||.|:..:.|||..:.||:.||..||.:|
plant     6 GEATADGDKASTENSKKRKLKTPMQVMALENFYNEHKYPTEEMKGKLAEEVGLTEKQVSGWFCHR 70

  Fly   347 RMK-WRHTRENLKS-GQEKQPSAVPESGGVFKTSTPSGDGTPQEALDYSSDSCSSVDLSEQAD 407
            |:| .||.:|:..: |.:.:.|.|.:.         .|.|..|       |||.|   ::|.|
plant    71 RLKDKRHVKEDGNAIGSQDRSSVVLQD---------RGSGLRQ-------DSCGS---TKQTD 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 19/53 (36%)
AT4G03250NP_192234.2 homeodomain 21..77 CDD:238039 19/55 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.