DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and HB-7

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_182191.1 Gene:HB-7 / 819280 AraportID:AT2G46680 Length:258 Species:Arabidopsis thaliana


Alignment Length:139 Identity:40/139 - (28%)
Similarity:59/139 - (42%) Gaps:25/139 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 NGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKW---- 350
            |.:|:       ||:.|.|.||:.|:.:..:....:.:||..|.|...||.:||||:|.:|    
plant    31 NNQRR-------FSDEQIKSLEMMFESETRLEPRKKVQLARELGLQPRQVAIWFQNKRARWKSKQ 88

  Fly   351 --------RHTRENLKSGQE---KQPSAVPESGGVFKTSTPSGDGTPQEALDYSSDSCSSVDLSE 404
                    |...:||.|..|   |:..|:.......|.:|..  .|.:|....|.|. :.|.||.
plant    89 LETEYNILRQNYDNLASQFESLKKEKQALVSELQRLKEATQK--KTQEEERQCSGDQ-AVVALSS 150

  Fly   405 QADEDDNIE 413
            ...|.:|.|
plant   151 THHESENEE 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 19/64 (30%)
HB-7NP_182191.1 Homeobox 35..85 CDD:395001 18/56 (32%)
HALZ 87..126 CDD:396657 7/38 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.