DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and HB4

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_182018.1 Gene:HB4 / 819100 AraportID:AT2G44910 Length:318 Species:Arabidopsis thaliana


Alignment Length:278 Identity:64/278 - (23%)
Similarity:99/278 - (35%) Gaps:71/278 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 PTLATNALLRFHQHQKQQHQQHHHHQH---HPKHLHQ------------QHKPPPHNSTTASALL 227
            |:|..| |:...........||.|:|:   ||:.:|.            :......||...|.|.
plant    22 PSLRLN-LMPLTTSSSSSSFQHMHNQNNNSHPQKIHNISWTHLFQSSGIKRTTAERNSDAGSFLR 85

  Fly   228 A-----PLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNG-----AHG------- 275
            .     ...|:..:.|.::.             ...:||.:|.::.|.|.     |.|       
plant    86 GFNVNRAQSSVAVVDLEEEA-------------AVVSSPNSAVSSLSGNKRDLAVARGGDENEAE 137

  Fly   276 -----HGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLT 335
                 .|||:|..:...|.||...|...|  .|..|...||..|::...:....:..||.:|||.
plant   138 RASCSRGGGSGGSDDEDGGNGDGSRKKLR--LSKDQALVLEETFKEHSTLNPKQKLALAKQLNLR 200

  Fly   336 DAQVKVWFQNRRMKWR-----------------HTRENLKSGQE-KQPSAVPESGGVFKTSTPSG 382
            ..||:|||||||.:.:                 .|.||.:..:| .:..|:..|..::...||..
plant   201 ARQVEVWFQNRRARTKLKQTEVDCEYLKRCCDNLTEENRRLQKEVSELRALKLSPHLYMHMTPPT 265

  Fly   383 DGTPQEALDYSSDSCSSV 400
            ..|...:.:..|.|.::|
plant   266 TLTMCPSCERVSSSAATV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 20/52 (38%)
HB4NP_182018.1 HD-ZIP_N 8..124 CDD:398351 22/115 (19%)
Homeobox 166..216 CDD:395001 20/51 (39%)
HALZ 218..261 CDD:128634 6/42 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.