DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and ESX1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_703149.1 Gene:ESX1 / 80712 HGNCID:14865 Length:406 Species:Homo sapiens


Alignment Length:230 Identity:62/230 - (26%)
Similarity:89/230 - (38%) Gaps:47/230 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 HTYPFVGLDKLFPGPYM----DYKSVLRPTPIRAAE-----HAAPTYPTLATNALLRFHQHQKQQ 195
            :|:..:|...|..|..:    |.|..:.....|..|     .:.|.|.|.|.|.:..........
Human     7 YTHSDIGYRSLAVGEDIEEVNDEKLTVTSLMARGGEDEENTRSKPEYGTEAENNVGTEGSVPSDD 71

  Fly   196 HQQHHHHQHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTS 260
            ..:.....|.|:   ||.:.||...........||     |:|.|:|:    :.||..::     
Human    72 QDREGGGGHEPE---QQQEEPPLTKPEQQQEEPPL-----LELKQEQE----EPPQTTVE----- 119

  Fly   261 PAAAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPD- 324
                          |.....|...|......:|||. .|..|:..|.:.||..|.:.:|   || 
Human   120 --------------GPQPAEGPQTAEGPQPPERKRR-RRTAFTQFQLQELENFFDESQY---PDV 166

  Fly   325 --RRKLAARLNLTDAQVKVWFQNRRMKWRHTRENL 357
              |.:||||||||:.:|:|||||||.||:..:..|
Human   167 VARERLAARLNLTEDRVQVWFQNRRAKWKRNQRVL 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 27/55 (49%)
ESX1NP_703149.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 3/13 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..142 27/140 (19%)
Nuclear localization signal. /evidence=ECO:0000255 138..143 3/5 (60%)
Homeobox 142..195 CDD:278475 27/55 (49%)
15 X 9 AA tandem repeats of P-P-x-x-P-x-P-P-x 244..378
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 341..364
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.