powered by:
Protein Alignment H2.0 and hmx1
DIOPT Version :9
Sequence 1: | NP_523488.2 |
Gene: | H2.0 / 33841 |
FlyBaseID: | FBgn0001170 |
Length: | 418 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001106998.1 |
Gene: | hmx1 / 797503 |
ZFINID: | ZDB-GENE-080204-54 |
Length: | 282 |
Species: | Danio rerio |
Alignment Length: | 72 |
Identity: | 32/72 - (44%) |
Similarity: | 45/72 - (62%) |
Gaps: | 3/72 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 280 NGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQ 344
:|...:..||..|:| :|.|||..|...||..|..::|::..:|..|||.|:||:.|||:|||
Zfish 138 SGPDTSEPGSARKKK---TRTVFSRSQVFQLESTFDMKRYLSSSERAGLAASLHLTETQVKIWFQ 199
Fly 345 NRRMKWR 351
|||.||:
Zfish 200 NRRNKWK 206
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.