DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and vsx2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_005158862.1 Gene:vsx2 / 796163 ZFINID:ZDB-GENE-001222-1 Length:393 Species:Danio rerio


Alignment Length:230 Identity:58/230 - (25%)
Similarity:80/230 - (34%) Gaps:86/230 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 QRFLG------KTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQG------------------ 283
            |..||      ..|:..||..|.. |...|:.|..|..|.|.|.|.|                  
Zfish    49 QEILGLNKEPSSAPRSTLDSFPAG-AHLLASRSMLGPAGVGVGVGMGLIGPGGIPSFYSQPAFLE 112

  Fly   284 ----------------------NASAGSNG-------------------KRKRSWSRAVFSNLQR 307
                                  |.||.|:.                   |||:...|.:|::.|.
Zfish   113 VLSDAQNVHLQPLSRTVGPLEHNQSASSDSDDVSSSERKMSKSSLSQSKKRKKRRHRTIFTSYQL 177

  Fly   308 KGLEIQFQQQKYITKPD---RRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEK---QPS 366
            :.||..|.:..|   ||   |..||.:..|.:.:::|||||||.|||.        :||   :.|
Zfish   178 EELEKAFNEAHY---PDVYAREMLAMKTELPEDRIQVWFQNRRAKWRK--------REKCWGRSS 231

  Fly   367 AVPE---SGGVFKTSTPSGDGTPQEALDYSSDSCS 398
            .:.|   .|.:.:.|.|..:...:.|.|...|||:
Zfish   232 VMAEYGLYGAMVRHSIPLPESILKSAKDGIMDSCA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 21/55 (38%)
vsx2XP_005158862.1 Homeobox 170..221 CDD:278475 20/53 (38%)
OAR 338..355 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.