DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment H2.0 and ankef1

DIOPT Version :9

Sequence 1:	NP_523488.2	Gene:	H2.0 / 33841	FlyBaseID:	FBgn0001170	Length:	418	Species:	Drosophila melanogaster
Sequence 2:	XP_031757648.1	Gene:	ankef1 / 779804	XenbaseID:	XB-GENE-980460	Length:	795	Species:	Xenopus tropicalis

Alignment Length:	77	Identity:	21/77 - (27%)
Similarity:	34/77 - (44%)	Gaps:	9/77 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly    21 HMYGECEVNPTLAKCP-DPVNVDHEL-------PTKESCASTTIVSTSPTSATSTTKVKLSFSVD 77
            :|.|:.:...|....| ||.::..||       |:||. .|..|...|..:|..|.:|.::|...
Frog   681 NMEGKAKGPKTQTPGPSDPAHIKQELIQTKLAVPSKEK-KSGIIHLNSMITAGETKRVDITFVPK 744

  Fly    78 RLLGSEPEESHR 89
            .:..:||..:.|
Frog   745 SVWIAEPTTAER 756

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID
H2.0	NP_523488.2	Homeobox	298..351	CDD:278475
ankef1	XP_031757648.1	ANK repeat	97..128	CDD:293786
		PHA02874	100..>304	CDD:165205
		ANK repeat	202..232	CDD:293786
		Ank_2	206..294	CDD:403870
		ANK repeat	234..265	CDD:293786
		ANK repeat	267..298	CDD:293786
		ANK repeat	300..337	CDD:293786
		ANK repeat	339..390	CDD:293786
		EFh	357..415	CDD:238008
		Ank_2	<511..573	CDD:403870
		ANK repeat	545..573	CDD:293786
		Ank_2	547..639	CDD:403870
		ANK repeat	575..606	CDD:293786
		ANK repeat	608..639	CDD:293786
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0488
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900