DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and RHOXF2B

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001093155.1 Gene:RHOXF2B / 727940 HGNCID:33519 Length:288 Species:Homo sapiens


Alignment Length:198 Identity:53/198 - (26%)
Similarity:84/198 - (42%) Gaps:62/198 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 KPPPHNSTTASALLAP-------LHSLTS--LQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATS 269
            :||...|...::||:|       |..:.:  |.||::.     |..::.....|....||.....
Human     2 EPPDQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEV-----KEEEEDAQPEPEQGTAAGEKLK 61

  Fly   270 QNGAHG-----------HGGGNG------QGN--ASAGSNGKRKRS----------WSRA----- 300
            ..||.|           .|||.|      :||  .::||:|..:.|          :||.     
Human    62 SAGAQGGEEKDGGGEEKDGGGAGVPGHLWEGNLEGTSGSDGNVEDSDQSEKEPGQQYSRPQGAVG 126

  Fly   301 -------------VFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKW-R 351
                         .|:.||.:.||..||::::.::..||:||..:|:|:..|::||:|||.|| |
Human   127 GLEPGNAQQPNVHAFTPLQLQELECIFQREQFPSEFLRRRLARSMNVTELAVQIWFENRRAKWRR 191

  Fly   352 HTR 354
            |.|
Human   192 HQR 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 23/71 (32%)
RHOXF2BNP_001093155.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..136 24/124 (19%)
Homeobox 140..190 CDD:278475 20/49 (41%)
Nuclear localization signal. /evidence=ECO:0000250 186..195 6/9 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.