DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Obox1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_082078.1 Gene:Obox1 / 71468 MGIID:1918718 Length:204 Species:Mus musculus


Alignment Length:176 Identity:45/176 - (25%)
Similarity:73/176 - (41%) Gaps:19/176 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 SLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNG---AHGHGGGNGQG---------NASA 287
            |.|:.|:..|.|....:|...:.|.|...::.:..:..   ....|.....|         |...
Mouse    22 SSQIPQEPARNLAFQMRQSPLVTPGSTTKSSLSVPERNLLKQESQGPSRQSGCMLLSDKYVNKQT 86

  Fly   288 GSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRH 352
            |....||....|.|::..|:..|:..|.:.:|..|....:||..:.:|..::|:||:|.|.|:| 
Mouse    87 GPMASRKFRKERTVYTKEQQGLLQKHFDECQYPNKKKIVELALSVGVTKREIKIWFKNNRAKYR- 150

  Fly   353 TRENLKSGQEKQPSAVPESGGVFKTSTPSGDGTPQEALDYSSDSCS 398
             |.||::.::    .:|||.|..|..:.| ...|..|.|.....||
Mouse   151 -RMNLQNIEQ----VLPESNGSSKAVSES-THFPVVASDNGESMCS 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 16/52 (31%)
Obox1NP_082078.1 homeodomain 95..153 CDD:238039 18/59 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.