DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Nkx6-3

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001102925.1 Gene:Nkx6-3 / 685102 RGDID:1597780 Length:262 Species:Rattus norvegicus


Alignment Length:199 Identity:58/199 - (29%)
Similarity:74/199 - (37%) Gaps:64/199 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 TPQQLLDIAPTSPAAAAAATSQNG---AHGHGGGNGQG---NASAGSNGK--------------- 292
            ||..:.||. :.|.|...::..:|   ..|.||.:.||   ....||..|               
  Rat    51 TPHGITDIL-SRPVATPNSSLLSGYPHVAGFGGLSSQGVYYGPQVGSFSKTGNEYPTRTRNCWAD 114

  Fly   293 -----------------------RKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNL 334
                                   .|:..:|..|:..|...||..|:|.||:..|:|.:||..|.:
  Rat   115 TGQDWRGSTRPCSNTPDPLSDTIHKKKHTRPTFTGHQIFALEKTFEQTKYLAGPERARLAYSLGM 179

  Fly   335 TDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPESGGVFKTSTPSGDGTPQE--------ALD 391
            |::||||||||||.|||.     ||..|...|.....||.      |||....|        .||
  Rat   180 TESQVKVWFQNRRTKWRK-----KSALEPSSSTPRAPGGA------SGDRAASENEDDEYNKPLD 233

  Fly   392 YSSD 395
            ..||
  Rat   234 PDSD 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 26/52 (50%)
Nkx6-3NP_001102925.1 Homeobox 143..197 CDD:395001 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.