DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Mnx1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001258203.1 Gene:Mnx1 / 682076 RGDID:1588091 Length:403 Species:Rattus norvegicus


Alignment Length:392 Identity:100/392 - (25%)
Similarity:140/392 - (35%) Gaps:78/392 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IVSTSPTSATSTTKVKLSFSVDRLLGSEPEESHRQSS-----SSPSTKSCCDGSILACCSFPHCF 115
            :::..|..|.||....|:....  |.:.|....|..|     ||.:::||...|           
  Rat    12 LLAVDPPRAASTQSAPLALVTS--LAATPSGPGRGGSGGGGTSSGASRSCSPAS----------- 63

  Fly   116 SQANAE--SRRFGHATLPPTFTPTSSHTYP---FVGL---DKLFPGPYMDYKSVLRPTPIRAAEH 172
            |:|.|.  .|....:..||..........|   |:|.   .....||...:.   ...|..||..
  Rat    64 SEATAAPGDRLRAESPSPPRLLTAHCALLPKPGFLGAGGGGGAAGGPGTPHH---HAHPGAAAAA 125

  Fly   173 AAPTYPTLATNALLRFHQHQKQ-------QHQQHHHHQHHPKHLHQQHKPPPHNSTTASALLAPL 230
            ||......|....|..|....|       |...:.|..:            .:::..|:|.||..
  Rat   126 AAAAAAAAAGGLALGLHPGGAQGGAGLPAQAALYGHPVY------------SYSAAAAAAALAGQ 178

  Fly   231 HSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNG-------QGNASAG 288
            |...|....|.|    |..|..     |..|....|.|.|..........|       ..::.|.
  Rat   179 HPALSYSYPQVQ----GAHPAH-----PADPIKLGAGTFQLDQWLRASTAGMILPKMPDFSSQAQ 234

  Fly   289 SN--GKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWR 351
            ||  ||.:|  .|..|::.|...||.||:..||:::|.|.::|..|.||:.|||:|||||||||:
  Rat   235 SNLLGKCRR--PRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWK 297

  Fly   352 HTRENLKSGQEKQPSAVPESGGVFKTSTPSGDGTPQEAL--DYSSDSCSS------VDLSEQADE 408
            .:::..:...::........||..|..|.  :.|.:|.|  ..|.|..|.      .|.....||
  Rat   298 RSKKAKEQAAQEAEKQKGSGGGAGKGGTE--EKTEEELLGPPVSGDKASGRRLRDLRDSDPDEDE 360

  Fly   409 DD 410
            ||
  Rat   361 DD 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 26/52 (50%)
Mnx1NP_001258203.1 Homeobox 244..297 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.