DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Pou6f2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001094472.2 Gene:Pou6f2 / 681092 -ID:- Length:684 Species:Rattus norvegicus


Alignment Length:410 Identity:80/410 - (19%)
Similarity:150/410 - (36%) Gaps:99/410 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SAASMEQSMPENLSTHMYGECEVNPTLAKCPDPVNVDHELPTKESCASTTIVSTSPTSATSTTKV 70
            :|.|..|.:...|.|:..|  ::..|:...|:|.      |:.::.:.|..:...|.:....|..
  Rat   316 NALSSLQGVTGQLVTNAQG--QIIGTIPLMPNPG------PSSQAASGTQGLQVQPITPQLLTNA 372

  Fly    71 KLSFSVDRLLGSE----------------PEESHRQSSSSPSTKSCCDGSILACCSFPH-CFSQA 118
            :... :..::|::                |.:...|||.:...::...|::|      | ...||
  Rat   373 QGQI-IATVIGNQILPVINTQGITLSPIKPGQQLHQSSQTSVGQAGTQGNLL------HLAHGQA 430

  Fly   119 NAESRRFGHATLPPTFTPTSSHTYPFVGLDKLFPGPYM-----------DYKSVLRPTPIR---- 168
            :........|    :.:.:||.:...:.:.:|...|..           :.:...:...||    
  Rat   431 STSQSPVRQA----SSSSSSSSSSSALSVGQLVSNPQTAAGEVDGVNLEEIREFAKAFKIRRLSL 491

  Fly   169 ------------AAEHAAPTYPTLATNALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPPPHNST 221
                        |.|..|.:...:..:.:||.|....|:.|:                     :|
  Rat   492 GLTQTQVGQALSATEGPAYSQSAICRHTILRSHFFLPQEAQE---------------------NT 535

  Fly   222 TASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNAS 286
            .||:|.|.|:  ..|....:.:: |..||:....|.|......|.|.:::.|       |..|.:
  Rat   536 IASSLTAKLN--PGLLYPARFEK-LDITPKSAQKIKPVLERWMAEAEARHRA-------GMQNLT 590

  Fly   287 --AGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMK 349
              .||...:||. .|..|:....:.|...|::..:.:..:..::|.:||.....|:|||.|:|..
  Rat   591 EFIGSEPSKKRK-RRTSFTPQALEILNAHFEKNTHPSGQEMTEIAEKLNYDREVVRVWFCNKRQA 654

  Fly   350 WRHTRENLKSGQEKQPSAVP 369
            .::|.:.||  |.:..||||
  Rat   655 LKNTIKRLK--QHEPTSAVP 672

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 13/52 (25%)
Pou6f2NP_001094472.2 Pou 470..579 CDD:419906 23/132 (17%)
Homeobox 603..657 CDD:395001 13/53 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.