DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Barx2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_003750505.1 Gene:Barx2 / 679701 RGDID:1584840 Length:290 Species:Rattus norvegicus


Alignment Length:193 Identity:67/193 - (34%)
Similarity:93/193 - (48%) Gaps:42/193 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 KPPPHNSTTASALLA--PLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSP--------------- 261
            :|.|.:|.|.|..|.  ||.|:    :|:|        |..:..:.||.|               
  Rat    54 RPKPLHSCTGSPSLRAYPLLSV----ITRQ--------PTVISHLVPTGPGLTPVNTRHAVAAEA 106

  Fly   262 -AAAAAATSQNGAHGHGG---GNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITK 322
             ||||||.:...|...||   .:.:......:..::|...||.:|:.||..|||.:||:|||::.
  Rat   107 AAAAAAAAAAAAAETPGGEALASSESETEQPTPRQKKPRRSRTIFTELQLMGLEKKFQKQKYLST 171

  Fly   323 PDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQE--KQPSAVPESGGVFKTSTPSGD 383
            |||..||..|.||..|||.|:|||||||:  :..||.|||  .:|...|:     |.|.|:.:
  Rat   172 PDRLDLAQSLGLTQLQVKTWYQNRRMKWK--KMVLKGGQEAPTKPKGRPK-----KNSIPTSE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 31/52 (60%)
Barx2XP_003750505.1 Homeobox 147..200 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.