powered by:
Protein Alignment H2.0 and shox
DIOPT Version :9
Sequence 1: | NP_523488.2 |
Gene: | H2.0 / 33841 |
FlyBaseID: | FBgn0001170 |
Length: | 418 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005167911.1 |
Gene: | shox / 664748 |
ZFINID: | ZDB-GENE-051030-21 |
Length: | 304 |
Species: | Danio rerio |
Alignment Length: | 75 |
Identity: | 29/75 - (38%) |
Similarity: | 40/75 - (53%) |
Gaps: | 6/75 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 289 SNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPD---RRKLAARLNLTDAQVKVWFQNRRMKW 350
:..|.|:..||..|:..|...||..|.:..| || |.:|:.||.|::|:|:|||||||.|.
Zfish 103 AQSKLKQRRSRTNFTLEQLNELERLFDETHY---PDAFMREELSQRLGLSEARVQVWFQNRRAKC 164
Fly 351 RHTRENLKSG 360
|.....:..|
Zfish 165 RKQENQMHKG 174
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.