DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Barhl2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_075245.1 Gene:Barhl2 / 65050 RGDID:620726 Length:384 Species:Rattus norvegicus


Alignment Length:291 Identity:85/291 - (29%)
Similarity:108/291 - (37%) Gaps:103/291 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GLDKLFPG-----PYM--------------DYKSVLRPTPIRAAE--HAAPTYPTLATNALLRFH 189
            |:|.:..|     |.|              |::|...|:|....:  ..||:.|...|  |....
  Rat    13 GIDTILSGAGSGSPGMMNGDFRSLGEARTTDFRSQATPSPCSEIDTVGTAPSSPISVT--LEPPE 75

  Fly   190 QHQKQQHQQHHHHQHH----------PKHLHQ---QHKPPPHNSTTA----SALLAPLHSLTSLQ 237
            .|......|||||.||          |....|   |.:|||...:.|    ||..||..|.:|  
  Rat    76 PHLVTDGPQHHHHLHHGQQPPPPSAPPAQSLQPSPQQQPPPQPQSAAQQLGSAAAAPRTSTSS-- 138

  Fly   238 LTQQQQRFLGKTPQQLLDI-APTSPAAAAAATSQ-------------NGAHG------------- 275
                   ||.|      || ..:.|.||.|..|.             |.||.             
  Rat   139 -------FLIK------DILGDSKPLAACAPYSTSVSSPHHTPKQECNAAHESFRPKLEQEDSKT 190

  Fly   276 --------------HG---GGNGQGNASAGS---NGKRKRSWSRAVFSNLQRKGLEIQFQQQKYI 320
                          ||   .|:.:..:|..|   ..|:.|. :|..||:.|...||..|::|||:
  Rat   191 KLDKREDSQSDIKCHGTKEEGDREITSSRESPPVRAKKPRK-ARTAFSDHQLNQLERSFERQKYL 254

  Fly   321 TKPDRRKLAARLNLTDAQVKVWFQNRRMKWR 351
            :..||..|||.|||||.|||.|:||||.||:
  Rat   255 SVQDRMDLAAALNLTDTQVKTWYQNRRTKWK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 29/52 (56%)
Barhl2NP_075245.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..134 33/122 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..237 13/83 (16%)
Homeobox 233..285 CDD:278475 29/51 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..384
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.