Sequence 1: | NP_523488.2 | Gene: | H2.0 / 33841 | FlyBaseID: | FBgn0001170 | Length: | 418 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001007135.1 | Gene: | lbx2 / 64276 | ZFINID: | ZDB-GENE-001206-2 | Length: | 257 | Species: | Danio rerio |
Alignment Length: | 240 | Identity: | 70/240 - (29%) |
---|---|---|---|
Similarity: | 98/240 - (40%) | Gaps: | 52/240 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 215 PPPHNSTTASALLAPL------------HSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAA--- 264
Fly 265 -AAATSQ-------NGAHG--HGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKY 319
Fly 320 ITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPES------------- 371
Fly 372 -GGVFKTSTPSGDGTPQEALDYSSDSCSSVDLSEQADEDDNIEIN 415 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
H2.0 | NP_523488.2 | Homeobox | 298..351 | CDD:278475 | 27/52 (52%) |
lbx2 | NP_001007135.1 | Required for convergent extension movement and hypaxial myogenesis during gastrulation. Required for the formation of thick and thin myofilaments. Required for myod1 expression in the pectoral fin bud. Required for continuous expression of cxcl12a in the posterior lateral mesoderm at the tail bud stage and in adaxial cells at the 10-somite stage. /evidence=ECO:0000269|PubMed:19216761, ECO:0000269|PubMed:22216300, ECO:0000269|PubMed:22406073 | 1..46 | 7/18 (39%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..43 | 7/15 (47%) | |||
Homeobox | 129..183 | CDD:395001 | 27/53 (51%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 206..257 | 12/55 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0488 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |