DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and hoxa3a

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_571609.1 Gene:hoxa3a / 58049 ZFINID:ZDB-GENE-000823-3 Length:411 Species:Danio rerio


Alignment Length:276 Identity:62/276 - (22%)
Similarity:110/276 - (39%) Gaps:76/276 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 YMDYKSVLRPTPIRAAEHAAPTYPTLATNALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPPPHN 219
            |.|..::....|.::|            |.|  .:...:||:.|..|.:      .:.|:|.  .
Zfish     6 YCDGSAIYSGLPYQSA------------NGL--GYDASQQQYLQALHAE------SEYHRPA--C 48

  Fly   220 STTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIA-----PTSPAAAAAATS---------- 269
            |..:..:.|.||  ||.::::..|:..| |...:.|.:     ||:|:..::.:|          
Zfish    49 SLQSPGISAGLH--TSNEMSEVCQQING-TQATVTDTSDNKQPPTAPSGPSSPSSLNQIPNIDSA 110

  Fly   270 -QNGAHGHGGGN------------------------------GQGNASAGSNGKRKRSWSRAVFS 303
             :|..|.....:                              |:..:..||...::   :|..::
Zfish   111 AKNPVHVSPTPSTRKHIFPWMKESRQNTKQKSCSIISVESCAGRQKSPPGSAASKR---ARTAYT 172

  Fly   304 NLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAV 368
            :.|...||.:|...:|:.:|.|.::|..||||:.|:|:||||||||::..::.|  |....|.|.
Zfish   173 SAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKGL--GMMPSPGAQ 235

  Fly   369 PESGGVFKTSTPSGDG 384
            .....|..:|...|.|
Zfish   236 SPHSPVSLSSGGGGGG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 23/52 (44%)
hoxa3aNP_571609.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..126 7/46 (15%)
Antp-type hexapeptide 127..132 0/4 (0%)
Homeobox 168..220 CDD:278475 23/51 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 223..250 6/28 (21%)
DUF4074 347..409 CDD:290032
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.