DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and hoxc6b

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_005172831.1 Gene:hoxc6b / 58045 ZFINID:ZDB-GENE-000822-1 Length:228 Species:Danio rerio


Alignment Length:253 Identity:59/253 - (23%)
Similarity:96/253 - (37%) Gaps:65/253 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 PIRAAEHAAPTYPTLATNALLR--FHQHQKQQHQQHHHHQHHPKHLHQQHK---PPPHNSTTASA 225
            |:|   |.:|....:|.|.:..  |:.||:...........:..::..|.|   |.....     
Zfish    33 PVR---HFSPYGAAVAQNRIYSNPFYSHQENVMFGSSRPYDYGSNMFYQDKDVLPSCRQG----- 89

  Fly   226 LLAPLHSLTSLQLTQQQQRFLGKT--PQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNASAG 288
                 ...|...|||......|||  |:..:.|.|.          ....:.|.|        .|
Zfish    90 -----FGQTQGSLTQDYASDQGKTMEPKGSVQIYPW----------MQRMNSHSG--------VG 131

  Fly   289 SNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHT 353
            ....|:|  .|.::|..|...||.:|...:|:|:..|.::|..|.|::.|:|:|||||||||:  
Zfish   132 YGSDRRR--GRQIYSRYQTLELEKEFHYNRYLTRRRRIEIANTLCLSERQIKIWFQNRRMKWK-- 192

  Fly   354 RENLKSGQEKQPSAVPESGGVFKTSTPSGDGTPQEALDYSSDSCSSVDLSEQADEDDN 411
                   :|...:::....|    |..:|..|.:|            :..|.|::|::
Zfish   193 -------KESNLTSILNDNG----SVGAGQDTDKE------------ETGETAEKDEH 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 22/52 (42%)
hoxc6bXP_005172831.1 Homeobox 140..192 CDD:278475 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.