DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and bsx

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_999892.1 Gene:bsx / 573364 ZFINID:ZDB-GENE-040628-4 Length:227 Species:Danio rerio


Alignment Length:305 Identity:73/305 - (23%)
Similarity:109/305 - (35%) Gaps:123/305 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 TLPPTFTPTSSHTYPFV---------GLDKLFPGPY----------MDYKSVLRPTPIRAAEHAA 174
            |.|....||...|..|:         .|.::||.|:          ::|...|.||||.|.    
Zfish     6 TSPVPQMPTQRSTSFFIEDILLHKPKPLREVFPSPFSNSIASRMPLLEYGYPLMPTPILAP---- 66

  Fly   175 PTYPTLATNALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLT 239
                                       |.|||     .|||..|.....|.:..|          
Zfish    67 ---------------------------HPHHP-----LHKPEHHPYFFTSGMQMP---------- 89

  Fly   240 QQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSN 304
                        .|....|..|                          |.:.:|::  :|.|||:
Zfish    90 ------------ALFQHHPELP--------------------------GKHCRRRK--ARTVFSD 114

  Fly   305 LQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKS-GQEKQPSAV 368
            .|..|||.:|:.|:|::.|:|.:||..|:|::.|||.||||||||  |.::..|: ..:|.|:.|
Zfish   115 SQLSGLEKRFEIQRYLSTPERVELATALSLSETQVKTWFQNRRMK--HKKQLRKTQDDQKTPNDV 177

  Fly   369 PES------GGVFKTSTPSGDG-TP--------QEALDYSSDSCS 398
            ..|      ..:.:.:|...:| :|        ::.:|...|.||
Zfish   178 DRSLENTSESEMHEKNTDGKNGMSPDRYTLDDNEDDVDIEDDICS 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 28/52 (54%)
bsxNP_999892.1 Homeobox 109..161 CDD:278475 28/53 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..227 16/68 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.