DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and BARHL1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_064448.1 Gene:BARHL1 / 56751 HGNCID:953 Length:327 Species:Homo sapiens


Alignment Length:180 Identity:50/180 - (27%)
Similarity:70/180 - (38%) Gaps:58/180 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 HLH--QQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQ 270
            ||.  |...|....:.|:|.|:..:                      |.|..|.:..|..:::.|
Human    77 HLQPGQLSAPAQSRTVTSSFLIRDI----------------------LADCKPLAACAPYSSSGQ 119

  Fly   271 NGAHGHGG--------------GNGQGNASAGSNGK--------------------RKRSWSRAV 301
            ..|...||              .....|||:.|..|                    :|...:|..
Human   120 PAAPEPGGRLAAKAAEDFRDKLDKSGSNASSDSEYKVKEEGDREISSSRDSPPVRLKKPRKARTA 184

  Fly   302 FSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWR 351
            |::.|...||..|::|||::..||.:|||.|||||.|||.|:||||.||:
Human   185 FTDHQLAQLERSFERQKYLSVQDRMELAASLNLTDTQVKTWYQNRRTKWK 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 28/52 (54%)
BARHL1NP_064448.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90 4/12 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..184 12/71 (17%)
Homeobox 182..235 CDD:395001 29/53 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.