DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and AgaP_AGAP004646

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_001688962.1 Gene:AgaP_AGAP004646 / 5667644 VectorBaseID:AGAP004646 Length:577 Species:Anopheles gambiae


Alignment Length:354 Identity:71/354 - (20%)
Similarity:110/354 - (31%) Gaps:141/354 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 HQHQKQQHQQHHHHQHHPKHLHQQHK---PPPHNSTTASALLAPLHSLTSL----------QLTQ 240
            |.:....|..||||.|||...|..|.   .|....:|:|.|:||  ::|:|          ....
Mosquito   130 HYYHHPHHHHHHHHHHHPHAHHPSHNGYMSPVQMQSTSSGLIAP--AITTLPPSVSTAASNSSVS 192

  Fly   241 QQQRF----------------------LGKTPQQLLDIAPTSPAAA--------------AAATS 269
            .|..|                      :..||.|.:....|:.|..              ||.|.
Mosquito   193 NQNSFPTNITSGYYNGYYSASTEGHTSIMDTPLQCVGTEVTNTALGLQELGMKLDRRIEEAAPTG 257

  Fly   270 Q------------------------------------------------------NGAHG----- 275
            |                                                      :..|.     
Mosquito   258 QQLQELGMRLRCDDASSDQDEFLDEERLMLDQSPDELDSNDGDIDDLESDNDLGEDVMHATSDGE 322

  Fly   276 ----------HGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAA 330
                      |..|...|:...|...||:|:    .::..|...||.:|...:|:|:..|.::|.
Mosquito   323 RIIYPWMKKIHVAGVANGSFQPGMEPKRQRT----AYTRHQILELEKEFHYNRYLTRRRRIEIAH 383

  Fly   331 RLNLTDAQVKVWFQNRRMKWRHTRE-------NLKSGQEKQPSAVPESG--GVFK--------TS 378
            .|.|::.|:|:|||||||||:...:       ..|:|.:.:.:|...:|  ||..        :|
Mosquito   384 TLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKNGDQSKSNASGSTGQSGVINNQKKSRKVSS 448

  Fly   379 TPSGDGTPQEALDYSSDSCSSVDLSEQAD 407
            |.....:.|:.....::...:..|...||
Mosquito   449 TTLSTKSKQQQQTLQNECLRTDSLESMAD 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 20/52 (38%)
AgaP_AGAP004646XP_001688962.1 Homeobox 352..404 CDD:278475 21/55 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.