DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and lbx1a

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001020703.1 Gene:lbx1a / 564103 ZFINID:ZDB-GENE-040724-40 Length:269 Species:Danio rerio


Alignment Length:259 Identity:72/259 - (27%)
Similarity:103/259 - (39%) Gaps:68/259 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 HKPPPHNST------------------TASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPT 259
            |.|||.||.                  .:..:....|.|:|    .::....|........:..|
Zfish    22 HLPPPANSNKPLTPFSIEDILNKPSVKRSYTICGTAHLLSS----GEKHPSTGHPLSNRALLTQT 82

  Fly   260 SPAAA----AAATSQ-------NGAHGHGGGN--GQGNASAGSNGKRKRSWSRAVFSNLQRKGLE 311
            ||..|    |:.|.:       ..|.|..|..  ||.|.      .:||..||..|:|.|...||
Zfish    83 SPLCALEELASKTFKGLEVSVLQAAEGRDGMTLFGQRNT------PKKRRKSRTAFTNHQIYELE 141

  Fly   312 IQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQE--KQPSAVP----- 369
            .:|..|||::..||.::|.:|.||:|||..||||||.|.:...|.:|:..|  |....||     
Zfish   142 KRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKAVGNVPFEKMA 206

  Fly   370 --------------ESGGVFKT-STPSGDGTPQEALDYSS---DSCSSVDLSEQADEDDNIEIN 415
                          :|..|..: |....:||.:..:..||   |..:|.:.||  |||:.|:::
Zfish   207 KLADLEKRVNGTLGDSSAVSPSRSNHEHEGTNKLHMSPSSPYTDHTTSKECSE--DEDEEIDVD 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 27/52 (52%)
lbx1aNP_001020703.1 Homeobox 128..181 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.