DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and gsx2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001020683.1 Gene:gsx2 / 561076 ZFINID:ZDB-GENE-041001-114 Length:242 Species:Danio rerio


Alignment Length:176 Identity:47/176 - (26%)
Similarity:69/176 - (39%) Gaps:59/176 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 QKQQHQQHHHHQHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDI 256
            |:..||| .....||.|.|                 ||:.:.||..:|..::.            
Zfish    90 QRMAHQQ-SPALAHPGHGH-----------------APVCTPTSFSVTDPRRY------------ 124

  Fly   257 APTSPAAAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYIT 321
                               |....|..:.|...||||.|:    .|::.|...||.:|....|::
Zfish   125 -------------------HCLSLGASDNSHIQNGKRMRT----AFTSTQLLELEREFSSNMYLS 166

  Fly   322 KPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSA 367
            :..|.::|..|||::.|||:||||||:|.:      |.|:..|.||
Zfish   167 RLRRIEIATYLNLSEKQVKIWFQNRRVKHK------KEGKGTQRSA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 21/52 (40%)
gsx2NP_001020683.1 COG5576 <132..242 CDD:227863 32/85 (38%)
Homeobox 144..196 CDD:278475 22/55 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.