DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and barx1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001020120.1 Gene:barx1 / 553644 ZFINID:ZDB-GENE-050522-28 Length:248 Species:Danio rerio


Alignment Length:243 Identity:72/243 - (29%)
Similarity:103/243 - (42%) Gaps:48/243 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 HQHQKQQHQQHHHHQHHP---KHLHQQHKPPPHNSTTASALLAPLHSLTS-------LQLTQQQQ 243
            |.:....|.....|::..   :.:...|.....:|.|...|...:|:|.|       |.|...|.
Zfish    10 HYYPPDAHLDQRSHRYRSFMIEEILTDHPDQKVSSPTGDLLKFGVHALLSARPYHNHLVLKADQT 74

  Fly   244 RFLGKTPQQLLDIAPTSPAAAA----AATSQNGAHGHG-------GGNGQGNASAGSNGKRKRSW 297
            ..| |.|...|..:..:|.::|    ||..|.|:..|.       .|.....|.|.|..|:.|. 
Zfish    75 GIL-KFPVSPLSCSLGAPLSSALLSGAAGLQVGSSSHHLPLDLHLRGKLDPGADAVSKTKKGRR- 137

  Fly   298 SRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQE 362
            ||.||:.||..|||.:|::|||::.|||..||..|.|:..|||.|:|||||||:           
Zfish   138 SRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWK----------- 191

  Fly   363 KQPSAVPESGGVFKTSTPSGDGTPQEALDYSSDSCSSVDLSEQADEDD 410
               ..|.:.||:...:.|.  |.|::         :|:..|||..|.:
Zfish   192 ---KIVLQGGGLESPTKPK--GRPKK---------NSIPTSEQLSEQE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 30/52 (58%)
barx1NP_001020120.1 Homeobox 138..191 CDD:278475 30/52 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..248 10/40 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.