DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and barhl1b

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001018142.1 Gene:barhl1b / 553186 ZFINID:ZDB-GENE-060118-2 Length:323 Species:Danio rerio


Alignment Length:315 Identity:81/315 - (25%)
Similarity:104/315 - (33%) Gaps:129/315 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SFSVDRLLGSEPEESHRQSSSSPSTKSCCDGSILACCSFPHCFSQANAESRRFGHATLPPTFTPT 137
            ||.:|.||      |||     |.:.....|..|.                  |....|..|:|.
Zfish     9 SFGIDSLL------SHR-----PGSPVISKGDSLV------------------GECRSPLEFSPR 44

  Fly   138 SSHTYPFVGLDKLFPGPYMDYKSVLRPTPIR-AAEHAAPTYPTLATNALLRFHQHQKQQHQQHH- 200
            |.       |:.....|         |:|.| ..|.||                 |:|.|...: 
Zfish    45 SD-------LESGCSSP---------PSPRRECVEDAA-----------------QRQGHPLAYA 76

  Fly   201 -HHQHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDI-APTSPAA 263
             |.||.|.....|.:      |.||:.|                         :.|| |...|.|
Zfish    77 SHLQHGPISAGSQPR------TVASSFL-------------------------IRDILADCKPLA 110

  Fly   264 AAAATSQNGAHGHGGG------------NGQGNASAGSNGK--------------------RKRS 296
            |.|..|.||......|            ....|:|:.|..|                    :|..
Zfish   111 ACAPYSSNGQPTQEAGRLASKIADDLIEKIHSNSSSDSEYKVKEEGDREISSSRDSPQVRLKKPR 175

  Fly   297 WSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWR 351
            .:|..|::.|...||..|::|||::..||.:|||.|||||.|||.|:||||.||:
Zfish   176 KARTAFTDHQLAQLERSFERQKYLSVQDRMELAASLNLTDTQVKTWYQNRRTKWK 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 28/52 (54%)
barhl1bNP_001018142.1 Oxidoreductase_nitrogenase 48..>88 CDD:295466 14/65 (22%)
Homeobox 178..230 CDD:278475 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.