DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and lhx9

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001032320.2 Gene:lhx9 / 550405 ZFINID:ZDB-GENE-050417-210 Length:396 Species:Danio rerio


Alignment Length:190 Identity:50/190 - (26%)
Similarity:66/190 - (34%) Gaps:74/190 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 GGG------NGQGNASAGSNGKRKR--------SWS---------------------------RA 300
            |||      ||.|....|...|||.        |:|                           |.
Zfish   208 GGGLALPYFNGTGTVQKGRPRKRKSPAMGIDIGSYSSGCNENDADHLDRDQQPYPPSQKTKRMRT 272

  Fly   301 VFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQP 365
            .|.:.|.:.::..|.........|.::||.:..||...::|||||.|.|:|  |..|:.      
Zfish   273 SFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFR--RNVLRQ------ 329

  Fly   366 SAVPESGGVFK---TSTP-----SGDGTPQEALDYSSDSCSSVDLSEQADEDDNIEINVV 417
                |:|||.|   ||.|     ||..||      .|.:.:..||:       |..|.||
Zfish   330 ----ENGGVDKADGTSLPPPSSDSGALTP------PSTATTLTDLT-------NPSITVV 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 17/79 (22%)
lhx9NP_001032320.2 LIM1_Lhx2 61..124 CDD:188853
LIM2_Lhx2_Lhx9 129..187 CDD:188763
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 248..272 0/23 (0%)
Homeobox 271..323 CDD:278475 16/51 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..365 14/52 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 377..396
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.