DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and pitx2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001017227.1 Gene:pitx2 / 549981 XenbaseID:XB-GENE-482492 Length:345 Species:Xenopus tropicalis


Alignment Length:220 Identity:70/220 - (31%)
Similarity:106/220 - (48%) Gaps:25/220 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 HQHQKQQHQQHHHHQHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQL 253
            |||..||||||.|  ||.:|.||||:.|...:.|          |.|:..:..|:....|...::
 Frog    25 HQHHHQQHQQHQH--HHQQHHHQQHQQPQPQAVT----------LVSMASSLGQRSGECKARLEV 77

  Fly   254 LDIAPT-SPAAAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQ 317
            ..|:.| ||.||....|      |...|...:....|..||:|. .|..|::.|.:.||..||:.
 Frog    78 HTISDTSSPEAADKDKS------HQSKNEDSSTDDPSKKKRQRR-QRTHFTSQQLQELEATFQRN 135

  Fly   318 KYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPESGGVFKTSTPSG 382
            :|.....|.::|...|||:|:|:|||:|||.||| .||..:..:..:....|:..|:.:   |..
 Frog   136 RYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWR-KRERNQQAELCKNGFGPQFNGLMQ---PYD 196

  Fly   383 DGTPQEAL-DYSSDSCSSVDLSEQA 406
            |..|..:. ::::...:|..||.::
 Frog   197 DMYPSYSYNNWAAKGLTSASLSTKS 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 22/52 (42%)
pitx2NP_001017227.1 XRCC4 <84..144 CDD:284132 19/66 (29%)
Homeobox 117..169 CDD:278475 22/51 (43%)
OAR 303..320 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.