DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and hoxb3

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001015971.1 Gene:hoxb3 / 548725 XenbaseID:XB-GENE-482576 Length:386 Species:Xenopus tropicalis


Alignment Length:270 Identity:68/270 - (25%)
Similarity:103/270 - (38%) Gaps:84/270 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 PPTFTPTSSHTYPFVGLDKLF------------PGPYMDYK----SVLRPTPIRAAEHAAPTYPT 179
            |....|||||      :|..|            .||.:..|    |.:||.  .::|.:.|..||
 Frog    28 PQQSFPTSSH------MDNEFQRSSCSLQSLGHSGPLVKAKNLNGSCMRPN--LSSEQSQPLSPT 84

  Fly   180 LATNALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPPPHNS----TTASALLAPLHSLTSLQLTQ 240
            ...::.......|.                 ...||.|..|    :.||..:.|       .:.:
 Frog    85 ANPSSNTNSSSSQA-----------------SLSKPSPAKSQASGSPASKQIFP-------WMKE 125

  Fly   241 QQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNL 305
            .:|....|:       :|.:|||.:.          ||......:||.     ||  :|..:::.
 Frog   126 SRQNSKQKS-------SPPAPAAESC----------GGDRSPPGSSAS-----KR--ARTAYTSA 166

  Fly   306 QRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPE 370
            |...||.:|...:|:.:|.|.::|..|||::.|:|:||||||||::.        .:|.......
 Frog   167 QLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKK--------DQKVKGMSSS 223

  Fly   371 SGGVFKTSTP 380
            |||...||||
 Frog   224 SGGASPTSTP 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 22/52 (42%)
hoxb3NP_001015971.1 Homeobox 160..212 CDD:306543 22/51 (43%)
DUF4074 325..384 CDD:315871
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.