DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Barhl1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001157658.1 Gene:Barhl1 / 54422 MGIID:1859288 Length:327 Species:Mus musculus


Alignment Length:133 Identity:44/133 - (33%)
Similarity:58/133 - (43%) Gaps:37/133 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 IAPTSPAAAAAATSQNGAHGHGGGNGQGNASAGSN-----------------------GKRKRSW 297
            :|...|.||.|..|.:|........|:..|.||.:                       |.|:.|.
Mouse   102 LADCKPLAACAPYSSSGQPAAPEPGGRLAAKAGEDFRDKLDKSVSSASSDSEYKVKEEGDREISS 166

  Fly   298 S--------------RAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRM 348
            |              |..|::.|...||..|::|||::..||.:|||.|||||.|||.|:||||.
Mouse   167 SRDSPPVRLKKPRKARTAFTDHQLAQLERSFERQKYLSVQDRMELAASLNLTDTQVKTWYQNRRT 231

  Fly   349 KWR 351
            ||:
Mouse   232 KWK 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 29/66 (44%)
Barhl1NP_001157658.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..181 10/67 (15%)
Homeobox 182..235 CDD:395001 29/53 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.