DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and PITX3

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_005020.1 Gene:PITX3 / 5309 HGNCID:9006 Length:302 Species:Homo sapiens


Alignment Length:111 Identity:36/111 - (32%)
Similarity:56/111 - (50%) Gaps:9/111 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 QNGAHGHGGGNGQGNASAGSNG--------KRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRR 326
            ::|..|....:.: .|||...|        |:|:...|..|::.|.:.||..||:.:|.....|.
Human    30 EHGCKGQEHSDSE-KASASLPGGSPEDGSLKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTRE 93

  Fly   327 KLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPESG 372
            ::|...|||:|:|:|||:|||.|||....:.::...|...|.|..|
Human    94 EIAVWTNLTEARVRVWFKNRRAKWRKRERSQQAELCKGSFAAPLGG 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 22/52 (42%)
PITX3NP_005020.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71 10/41 (24%)
Homeobox 66..119 CDD:395001 23/52 (44%)
OAR 258..275 CDD:397759
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 262..275
Nuclear localization signal. /evidence=ECO:0000255 268..272
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.