DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and PAX9

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001359005.1 Gene:PAX9 / 5083 HGNCID:8623 Length:341 Species:Homo sapiens


Alignment Length:240 Identity:54/240 - (22%)
Similarity:82/240 - (34%) Gaps:73/240 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EQSMPENLSTHMYG-ECEVNPTLAKCPDPVNVDHELPTKESCASTTIVSTSPTSATSTTKVKLSF 74
            :.::|.|   |:|. ...:....||.|.|..|. .:|     .|..:..|.|:|.:.|..:.:..
Human   151 QPALPYN---HIYSYPSPITAAAAKVPTPPGVP-AIP-----GSVAMPRTWPSSHSVTDILGIRS 206

  Fly    75 SVDRLLGSEPEESHRQSSSSPSTKSCCDGSILACCSF----PHCFS----QANAESRRFGHATLP 131
            ..|::..|.|..       ||..:   :.|.|...:|    ||..:    .|..:..::|.|   
Human   207 ITDQVSDSSPYH-------SPKVE---EWSSLGRNNFPAAAPHAVNGLEKGALEQEAKYGQA--- 258

  Fly   132 PTFTPTSSHTYPFVGLDKLFP-------GPYMDYKSVLRPTPIRAA---EHAAPTYPTLATN--- 183
            |...|...   .||....:.|       .|||.|.:.  |:...|.   :||..|  :|:.:   
Human   259 PNGLPAVG---SFVSASSMAPYPTPAQVSPYMTYSAA--PSGYVAGHGWQHAGGT--SLSPHNCD 316

  Fly   184 --ALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPPPHNSTTASAL 226
              |.|.|...|..:...|                    |.|||||
Human   317 IPASLAFKGMQAAREGSH--------------------SVTASAL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475
PAX9NP_001359005.1 PAX 6..131 CDD:238076
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 7..63
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 82..130
Interaction with KDM5B. /evidence=ECO:0000269|PubMed:12657635 168..189 7/26 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.