DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and PAX5

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_057953.1 Gene:PAX5 / 5079 HGNCID:8619 Length:391 Species:Homo sapiens


Alignment Length:275 Identity:52/275 - (18%)
Similarity:90/275 - (32%) Gaps:67/275 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NPTLAKCPDPVNVDHELPTKESCASTTIVSTSPTSATSTTKVKLSFSVDRLLGSEPEESHRQSSS 93
            |||:...    .:...|..:..|.:.|:.|.|              |::|::.::.::...|...
Human   106 NPTMFAW----EIRDRLLAERVCDNDTVPSVS--------------SINRIIRTKVQQPPNQPVP 152

  Fly    94 SPSTKSCCDGSILACCSFPHCFSQANAESRRFGHATLPPTFTPTSSHTYPFVGLDKLFPGPYMDY 158
            :.|......||:          :|.::.|            |.::..:|...|:..: ..|..|.
Human   153 ASSHSIVSTGSV----------TQVSSVS------------TDSAGSSYSISGILGI-TSPSADT 194

  Fly   159 KSVLRPTPIRAAEHAAPTYPTLATNALLR-------FHQHQKQQHQQHHHHQHHPKHLHQQHKPP 216
            ....|...|:  |...|...:|.....||       |.|.|.:...:....||:...........
Human   195 NKRKRDEGIQ--ESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIK 257

  Fly   217 PHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAA---------AATSQNG 272
            |..:|..||:.:....|..:     :......||   .||..:.|...:         |:|:..|
Human   258 PEQTTEYSAMASLAGGLDDM-----KANLASPTP---ADIGSSVPGPQSYPIVTGRDLASTTLPG 314

  Fly   273 AHGHGGGNGQGNASA 287
            ...|....|||:.||
Human   315 YPPHVPPAGQGSYSA 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475
PAX5NP_057953.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
PAX 16..140 CDD:128645 10/51 (20%)
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 19..75
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 94..142 10/53 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..218 8/38 (21%)
Pax2_C 279..389 CDD:403565 14/54 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.