DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and PAX4

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001353039.1 Gene:PAX4 / 5078 HGNCID:8618 Length:351 Species:Homo sapiens


Alignment Length:250 Identity:66/250 - (26%)
Similarity:95/250 - (38%) Gaps:52/250 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GPYMDYKS-VLRPTPIRAAEHAAPTYPTLATNALLRFH-------QHQKQQHQQHHHHQHHPKHL 209
            |.|  |:: ||.|..|..::....|.|.:|..|.|:..       :.|:|...:         .|
Human    59 GRY--YRTGVLEPKGIGGSKPRLATPPVVARIAQLKGECPALFAWEIQRQLCAE---------GL 112

  Fly   210 HQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAH 274
            ..|.|.|     :.|::...|.:|      |:.|   |....:|...|..:||.....:......
Human   113 CTQDKTP-----SVSSINRVLRAL------QEDQ---GLPCTRLRSPAVLAPAVLTPHSGSETPR 163

  Fly   275 GHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQV 339
            |...|.|..|              |.:||..|.:.||.:||:.:|.....|.|||...:|.:..|
Human   164 GTHPGTGHRN--------------RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTV 214

  Fly   340 KVWFQNRRMKWRHTRENLKSGQE----KQPSAVPESGGVFKTSTPSGDGTPQEAL 390
            :|||.|||.|||. :|.||...:    .|...||.......::..|....|..||
Human   215 RVWFSNRRAKWRR-QEKLKWEMQLPGASQGLTVPRVAPGIISAQQSPGSVPTAAL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 22/52 (42%)
PAX4NP_001353039.1 PAX 5..129 CDD:128645 19/85 (22%)
Homeobox 174..226 CDD:306543 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.