DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and PAX1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_006183.2 Gene:PAX1 / 5075 HGNCID:8615 Length:534 Species:Homo sapiens


Alignment Length:220 Identity:46/220 - (20%)
Similarity:64/220 - (29%) Gaps:65/220 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 EPEESHRQSSSSPSTKSCCDGSILACCSFPHCFSQANAESRRFGHATLPPTFTPTSSHTYPFVGL 147
            |.:..:.||:|:.|..    |..|..|::|        .|.:.|              .|...|.
Human   346 EADIKYTQSASTLSAV----GGFLPACAYP--------ASNQHG--------------VYSAPGG 384

  Fly   148 DKLFPGPYMDYKSVLRPTPIRAAEHAAPTYPTLATN-----ALLRFHQHQKQQHQQHHHHQHHPK 207
            ..|.|||         |.|.......||....:|.:     |.:.|                  |
Human   385 GYLAPGP---------PWPPAQGPPLAPPGAGVAVHGGELAAAMTF------------------K 422

  Fly   208 HLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQ-QLLDIAPTSPAAAAAATSQN 271
            |      |....|..|.|......|:.......:.:...|.:|: :........|.|...|.:..
Human   423 H------PSREGSLPAPAARPRTPSVAYTDCPSRPRPPRGSSPRTRARRERQADPGAQVCAAAPA 481

  Fly   272 GAHGHGGGNGQGNASAGSNGKRKRS 296
            ...|..||..:..||||..|.|..|
Human   482 IGTGRIGGLAEEEASAGPRGARPAS 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475
PAX1NP_006183.2 PAX 98..225 CDD:238076
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 101..157
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 176..224
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 424..480 10/55 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 492..511 7/15 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.