DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Nobox

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001178942.1 Gene:Nobox / 502759 RGDID:1563929 Length:524 Species:Rattus norvegicus


Alignment Length:231 Identity:56/231 - (24%)
Similarity:83/231 - (35%) Gaps:54/231 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 PKHLHQQHKPPPHNSTTASALLAPL-----HSLTSLQLTQQQQRFLGKTPQQLLD-------IAP 258
            |:...|..:.||.:.       |||     ..|:||......:|.|.||....:|       .||
  Rat    20 PRTAAQDTEGPPQDP-------APLVQGDPDKLSSLPRAGLGKRPLSKTSGDCIDADTCRVHTAP 77

  Fly   259 TSPAAAAAATSQNGAH-------------GHGGGNGQGNASAGSNGKRK---------RSWSRAV 301
             |||..:....:.|:.             ..|.|......:......:|         |..:|.:
  Rat    78 -SPAVCSPKPQKKGSSLQEKKAETVKPSMSAGPGQVPNPLNFRERDLKKEPLEATCQFRKKTRTL 141

  Fly   302 FSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQE---- 362
            :.:.|.:.||..||:..|.....|.::|..:.:|..::.|||||||.|||.. |.|...::    
  Rat   142 YRSDQLEELERIFQEDHYPDSDKRHEIAQMVGVTPQRIMVWFQNRRAKWRKV-EKLNEKEDNNGP 205

  Fly   363 -------KQPSAVPESGGVFKTSTPSGDGTPQEALD 391
                   .|..:.||..|...|....|...|:..||
  Rat   206 APPRANSSQCRSAPELLGPMPTDLEPGPVPPENILD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 18/52 (35%)
NoboxNP_001178942.1 COG5576 82..>192 CDD:227863 24/109 (22%)
Homeobox 138..191 CDD:278475 18/52 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.