DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Hoxa7

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001102703.2 Gene:Hoxa7 / 500126 RGDID:1587253 Length:229 Species:Rattus norvegicus


Alignment Length:128 Identity:38/128 - (29%)
Similarity:66/128 - (51%) Gaps:22/128 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 SAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKW 350
            |:|.:.||    .|..::..|...||.:|...:|:|:..|.::|..|.||:.|:|:|||||||||
  Rat   124 SSGPDRKR----GRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKW 184

  Fly   351 RHTRENLKSGQEKQPSAVPESGGVFKTSTPSGDGTPQEALDYSSDSCSSVDLSEQADEDDNIE 413
            :...::    :.:.|:||||            |..|  ::..::|.....:..|:.:|::..|
  Rat   185 KKEHKD----ESQAPTAVPE------------DAVP--SVSTAADKADEEEEEEEEEEEEEEE 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 22/52 (42%)
Hoxa7NP_001102703.2 Homeobox 133..185 CDD:278475 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.