DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Dlx6

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_008760963.2 Gene:Dlx6 / 500023 RGDID:1561539 Length:298 Species:Rattus norvegicus


Alignment Length:269 Identity:74/269 - (27%)
Similarity:104/269 - (38%) Gaps:95/269 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 NALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPP-------PHNSTTASALLA---PLHSLTSLQ 237
            :|.:.|.|.|:||.||....|...:...||..||       ||:..|:.|:..   |||.|.|  
  Rat    19 SAFMEFGQQQQQQQQQQQQQQQQQQQQQQQPPPPPPPPPPQPHSQQTSPAMAGAHYPLHCLHS-- 81

  Fly   238 LTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGH---------GGGNGQG---------- 283
                                  :.||||||.|.:..|.|         ||||...          
  Rat    82 ----------------------AAAAAAAAGSHHHHHQHHHHGSPYASGGGNSYNHRSLAAYPYM 124

  Fly   284 -------------NASAGS----------------------NGKRKR-SWSRAVFSNLQRKGLEI 312
                         |:||.:                      |||.|: ...|.::|:||.:.|..
  Rat   125 SHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNH 189

  Fly   313 QFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPESGGVFKT 377
            :|||.:|:..|:|.:|||.|.||..|||:||||:|.|::...:...:..|..|  :|.|..:   
  Rat   190 RFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHESDP--LPGSAAL--- 249

  Fly   378 STPSGDGTP 386
             :|.....|
  Rat   250 -SPRSPALP 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 26/52 (50%)
Dlx6XP_008760963.2 COG5576 124..280 CDD:227863 39/140 (28%)
Homeobox 175..229 CDD:395001 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.