DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Lbx1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001040573.1 Gene:Lbx1 / 499362 RGDID:1564197 Length:285 Species:Rattus norvegicus


Alignment Length:284 Identity:72/284 - (25%)
Similarity:97/284 - (34%) Gaps:106/284 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 HKPPPHNSTT------------------------ASALLAPL--HSLTSLQLTQQQQRFLGKTPQ 251
            |.|||.||..                        |:.|||..  |:...|.|..:..        
  Rat    22 HLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAPGGLPLAGRAL-------- 78

  Fly   252 QLLDIAPTSPAAA----AAATSQ-------NGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNL 305
                ::.|||..|    |:.|.:       ..|.|..|....|....    .:||..||..|:|.
  Rat    79 ----LSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQT----PKKRRKSRTAFTNH 135

  Fly   306 QRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKS----------- 359
            |...||.:|..|||::..||.::|.:|.||:|||..||||||.|.:...|.:|:           
  Rat   136 QIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPS 200

  Fly   360 ------------------------------------GQEKQPSAVPES--GGVFKTSTPSGDGTP 386
                                                |....|...|::  ||..:.| |:...|.
  Rat   201 GQMDIVALAELEQNSEASGGGGGGGGGGCGRAKSRPGSPALPPGAPQAPGGGPLQLS-PASPLTD 264

  Fly   387 QEALDYSSDSCSSVDLSEQADEDD 410
            |.|   ||..||..:..|:.|.||
  Rat   265 QRA---SSQDCSEDEEDEEIDVDD 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 27/52 (52%)
Lbx1NP_001040573.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 6/13 (46%)
Homeobox 128..181 CDD:278475 27/52 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..285 16/76 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.