DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Tlx1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001102636.1 Gene:Tlx1 / 499361 RGDID:1563655 Length:333 Species:Rattus norvegicus


Alignment Length:284 Identity:63/284 - (22%)
Similarity:81/284 - (28%) Gaps:133/284 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 PKHLHQQHKPPPH-------NSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPT---S 260
            |.|||..|..|..       ||......:.|...|      |..:..||    .|:..|.|   .
  Rat     6 PHHLHPGHAEPISFGIDQILNSPDQGGCMGPASRL------QDGEYGLG----CLVGGAYTYGGG 60

  Fly   261 PAAAAAATSQNGAHGHGG------------------------------------GNGQGNASAGS 289
            .:||.|.....||:|.||                                    |.|.|.|.||.
  Rat    61 GSAAGAGAGGTGAYGTGGPGGPGGPAGGGGGACSMGPLAGSYNVNMALAGGPGPGGGGGGAGAGG 125

  Fly   290 NG--------------------------------------------------------------- 291
            .|                                                               
  Rat   126 AGALSAAGVIRVPAHRPLAGAVAHPQPLATGLPTVPSVPAVPGVNNLTGLTFPWMESNRRYTKDR 190

  Fly   292 ------------KRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQ 344
                        |:|:  .|..|:.||...||.:|.:|||:...:|..||..|.:||||||.|||
  Rat   191 FTGHPYQNRTPPKKKK--PRTSFTRLQICELEKRFHRQKYLASAERAALAKALKMTDAQVKTWFQ 253

  Fly   345 NRRMKWRHTRENLKSGQEKQPSAV 368
            |||.|||......:..:.:|.:.:
  Rat   254 NRRTKWRRQTAEEREAERQQANRI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 27/52 (52%)
Tlx1NP_001102636.1 Homeobox 207..260 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.