DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Tlx3

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_573065.4 Gene:Tlx3 / 497881 RGDID:1564190 Length:291 Species:Rattus norvegicus


Alignment Length:313 Identity:77/313 - (24%)
Similarity:113/313 - (36%) Gaps:84/313 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SPTSA-TSTTKVKLSFSVDRLLGSEPEESHRQSSSSPSTKSCCDGSI-----LACCSFPHCFSQA 118
            :|.|| |......:||.:|::|.| |::....:...|...|...|..     .|..|.|..|:..
  Rat     3 APASAQTPHPHEPISFGIDQILNS-PDQDSAPAPRGPDGASYLGGPPGGRPGAAYPSLPASFAGL 66

  Fly   119 NAESRRFGHATLPPTFTPTSSHTYPFVGLDKLFPGPYMDYKSVLRPTPIRAAEHAAPTYPTLATN 183
            .|.....|..::..:..|......|   ..:..||..        |.|:.:|..|.|:.||:::.
  Rat    67 GAPFEDAGSYSVNLSLAPAGVIRVP---AHRPLPGAV--------PPPLPSALPAMPSVPTVSSL 120

  Fly   184 ALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGK 248
            ..|.|...:..:..                   ..:..||:|.|.|. ::|         |.:|.
  Rat   121 GGLNFPWMESSRRF-------------------VKDRFTAAAALTPF-TVT---------RRIGH 156

  Fly   249 TPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQ 313
            ..|.     .|.|                              |||:  .|..||.:|...||.:
  Rat   157 PYQN-----RTPP------------------------------KRKK--PRTSFSRVQICELEKR 184

  Fly   314 FQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPS 366
            |.:|||:...:|..||..|.:||||||.||||||.|||......:..:.:|.|
  Rat   185 FHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQAS 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 27/52 (52%)
Tlx3XP_573065.4 Homeobox 169..223 CDD:395001 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.