DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and alx4b

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001297007.1 Gene:alx4b / 497424 ZFINID:ZDB-GENE-050208-140 Length:259 Species:Danio rerio


Alignment Length:197 Identity:43/197 - (21%)
Similarity:59/197 - (29%) Gaps:61/197 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PTFTPTSSHTY------PF-----VGLDKLFPGPYMDYKSVL-RPTPIRAAEHAAPTYPTLATNA 184
            |||.|....||      ||     ...|....|.|..|...: ||.....:|.:     .|...|
Zfish    47 PTFLPAKGQTYGEKPRSPFHQDCPTLDDSTAEGAYSKYHLFMQRPACKSPSEDS-----KLEDGA 106

  Fly   185 LL-----------------RFHQHQKQQHQQHHHHQH------HPKHLHQQHKPP-PHNSTTASA 225
            |:                 ||  .|.||.:.|....:      .|::..|...|. ...|::||.
Zfish   107 LISCYGVVSESPGKWRKRERF--GQMQQVRTHFSTAYELPLLTRPENYAQIQNPSWLSGSSSASP 169

  Fly   226 L---LAPLHSLTSLQLTQQQQR-----FLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQ 282
            :   :.|..:::|.........     |||.          .||..:.|.|......|..|..|.
Zfish   170 VPGCVVPCDTVSSCMTPHPHSASGVSDFLGM----------PSPGGSMAQTHMGSLFGSSGVGGT 224

  Fly   283 GN 284
            .|
Zfish   225 IN 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475
alx4bNP_001297007.1 OAR 235..252 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.