DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment H2.0 and NPM1

DIOPT Version :9

Sequence 1:	NP_523488.2	Gene:	H2.0 / 33841	FlyBaseID:	FBgn0001170	Length:	418	Species:	Drosophila melanogaster
Sequence 2:	NP_001341935.1	Gene:	NPM1 / 4869	HGNCID:	7910	Length:	294	Species:	Homo sapiens

Alignment Length:	52	Identity:	16/52 - (30%)
Similarity:	24/52 - (46%)	Gaps:	4/52 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   361 QEKQPSAVPESGGVFKTSTPSGDG-TPQEALDYSSDSCSSVDLSEQADEDDN 411
            :|:....:..||   |.|.|.|.. .||:.:..::|.....|..|..||||:
Human   129 EEEDVKLLSISG---KRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDD 177

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
H2.0	NP_523488.2	Homeobox	298..351	CDD:278475
NPM1	NP_001341935.1	Required for interaction with SENP3	1..186		16/52 (31%)
		Necessary for interaction with APEX1. /evidence=ECO:0000269\|PubMed:19188445	1..117
		Nucleoplasmin	18..117	CDD:397268
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	120..247		16/52 (31%)
		Nuclear localization signal. /evidence=ECO:0000255	152..157		2/4 (50%)
		Nuclear localization signal. /evidence=ECO:0000255	191..197
		Required for nucleolar localization	243..294
		NPM1-C	245..291	CDD:406641
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0488
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900