DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and AgaP_AGAP004647

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_001231056.3 Gene:AgaP_AGAP004647 / 4576785 VectorBaseID:AGAP004647 Length:431 Species:Anopheles gambiae


Alignment Length:145 Identity:48/145 - (33%)
Similarity:69/145 - (47%) Gaps:21/145 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 NGQGNASAGS------NGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQ 338
            |..||:|.|:      .|..||  ||..|::.|...||.:|...:|:.:|.|.:|..:|.||:.|
Mosquito    16 NADGNSSNGAFAADSYIGSTKR--SRTAFTSSQLVELEKEFHSNRYLCRPRRIELTRKLALTERQ 78

  Fly   339 VKVWFQNRRMKWRHTRENLKSGQEKQPSAVPESGGVFKTSTPSGDGTPQEALDYSSD-SCSSVDL 402
            :|:||||||||.:....|:|...:            .|:|....||....:...||. |..||..
Mosquito    79 IKIWFQNRRMKHKKESSNIKIISK------------IKSSCHCTDGESSRSPKISSPASPHSVQA 131

  Fly   403 SEQADEDDNIEINVV 417
            :...|:|.|...|:|
Mosquito   132 TIVGDDDHNGHQNIV 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 24/52 (46%)
AgaP_AGAP004647XP_001231056.3 Homeobox 38..91 CDD:278475 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.