DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and E5

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster


Alignment Length:453 Identity:113/453 - (24%)
Similarity:157/453 - (34%) Gaps:148/453 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SCASTTIVSTSPTSATSTTKVKLSFSVDRLLGSEPEESHRQSS------SSPSTKSCCDGSILAC 108
            :.:||::.::|..||::::|.||:||:|.::|   |.|.|.:.      |||..:|         
  Fly    28 AASSTSVSASSTVSASASSKPKLAFSIDSIVG---ESSTRSAPLRVSVISSPPPRS--------- 80

  Fly   109 CSFPHCFSQANAESRRFGHATL------------PPTFTPTS-SHTYPFVGLDKLFPG------- 153
             ..|...:..|...||.....:            .|..:|.| |.:.|..|.:....|       
  Fly    81 -ESPASPTNTNNSGRRTPRGYIYCRRRDSLDRSRSPQRSPVSRSPSPPNAGGNPAAAGNTAKSGD 144

  Fly   154 -------PYMDYKSVLRPTPI----------------RAAEHAAPTYPT------LATN-----A 184
                   |    .:::||.|:                .|...|.|.:|.      ||..     |
  Fly   145 PSSGTGNP----PTLIRPLPLPAPNLALIGNRTSPNAMAVRMAGPPHPPSQPPPFLAAQFQMAAA 205

  Fly   185 LLRFHQHQKQQHQQ----------HHHHQH---------------HPKHLHQQHKPPPHNSTTAS 224
            |...||.|:||.||          |..|.|               ||.|      ||||..    
  Fly   206 LAHHHQQQQQQQQQQLPPVPTGPPHGPHPHLPPGQIPLGIFPGGPHPGH------PPPHGH---- 260

  Fly   225 ALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNASAGS 289
                  |.             .|..|..:.|..|..|...:       .||.......||.....
  Fly   261 ------HP-------------FGSAPHLIRDSYPLYPWLLS-------RHGRIFPRFPGNFLFQP 299

  Fly   290 NGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTR 354
            ..|.||  .|..||..|...||..|:...|:...:|::||..|:||:.||||||||||.|.:..:
  Fly   300 FRKPKR--VRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKRMQ 362

  Fly   355 ENLKSGQEKQPSAVPESGGVFKTSTPSGDGTPQEALDYSSDSCSSVDLSEQAD---EDDNIEI 414
            :....|.:.:.:....|||     ...|||......|.|..|....:..|..|   |||..|:
  Fly   363 QEGGDGSDTKSNKGSSSGG-----GGGGDGEDDAKHDGSQHSYEDAEDPEDEDEIEEDDEDEV 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 25/52 (48%)
E5NP_524825.1 Homeobox 307..359 CDD:278475 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.