DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Dr

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster


Alignment Length:464 Identity:101/464 - (21%)
Similarity:160/464 - (34%) Gaps:148/464 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SAASMEQSMPENLS-THMYG-ECEVNPTLAKCPDPVNVDH-------------ELPTKESCASTT 55
            |:.:|..|...||| :|..| ....:||   .|..:.:.|             :...::..|:..
  Fly    52 SSGNMTSSNLTNLSPSHPAGLNALASPT---SPSALLLAHQQHLLQQHQQHQQQQQQQQQAAALQ 113

  Fly    56 IVSTSPTS--ATSTTKVKLSFSVDRLLG-SEPEESHRQSSSSPS--TKSCCDGSILACCSFP--- 112
            :.:..|.:  ...||....:|||..||. :.|.....|::..|.  |.|.....|....|.|   
  Fly   114 LAAVHPPAHHLHKTTSRLSNFSVASLLADTRPRTPPNQAADGPQNLTSSAATSPISQASSTPPPP 178

  Fly   113 ----------------------------HCFSQANAESRRF------------GHATLPPTFTPT 137
                                        |..:.|:|:.:..            ..|..||..|.:
  Fly   179 PASAAAQVPANTFHPAAVAHHAHLLQAAHAAAAAHAQHQAMAAQLRQQQQQADARANSPPASTSS 243

  Fly   138 SSHTYPFVGLDKLFPGPYMDYKSVLRPTPIRAAEHAAPTYPTLA-TNALLRFHQHQKQQHQQHHH 201
            :..:.|.        |..:..:..:..||.:...|:    |..: |::.|.:.:...|.|:..|.
  Fly   244 TPSSTPL--------GSALGSQGNVASTPAKNERHS----PLGSHTDSELEYDEEMLQDHEADHD 296

  Fly   202 HQHHP------------------------KHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQ 242
            .:...                        |.|...|.||| .|...|.:|:|. :|.|       
  Fly   297 EEEDSIVDIEDMNADDSPRSTPDGLDGSGKSLESPHGPPP-GSHMQSTILSPA-ALAS------- 352

  Fly   243 QRFLGKTPQQLLDIAPTS-PAAAAAATSQNGAHG-------------------HGGGNGQGNASA 287
                |..|     |.||. .|.||||.:..|..|                   .|.|.| |:|:.
  Fly   353 ----GHVP-----IRPTPFSALAAAAVAWTGMGGGVPWPGTRQMPPFGPPGMFPGAGFG-GDANE 407

  Fly   288 GSNGK---RKRSWS---RAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNR 346
            ....|   ||...:   |..|:..|...||.:|::::|::..:|.:.::.|.||:.|||:|||||
  Fly   408 PPRIKCNLRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIWFQNR 472

  Fly   347 RMKWRHTRE 355
            |.|.:..:|
  Fly   473 RAKAKRLQE 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 21/55 (38%)
DrNP_477324.1 Homeobox 424..477 CDD:278475 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.