DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and hoxc8a

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001005771.1 Gene:hoxc8a / 449648 ZFINID:ZDB-GENE-990415-114 Length:250 Species:Danio rerio


Alignment Length:305 Identity:72/305 - (23%)
Similarity:104/305 - (34%) Gaps:105/305 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 CSFPHCFSQANAESRRFGHATLPPTFTPTSSHTYPF-----VGLDKLFPGPYMDYKSVLRPTPIR 168
            |.||.  |.|.:.:..:||....|.|...|.|...|     .|:..  ||        .:..|..
Zfish    26 CRFPQ--SVARSHTLVYGHGAAAPGFQHPSHHVQDFFHHGTTGISN--PG--------YQQNPCA 78

  Fly   169 AAEHAAPTYPTLATNALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPPPHNSTTASALLAPLHSL 233
            .|.|...|          :|:.::....|                               ||:. 
Zfish    79 LACHGDAT----------KFYGYEALPRQ-------------------------------PLYG- 101

  Fly   234 TSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSW- 297
                  .||:..|.:.|.               ..|.|..:   .|.|||:.|..|:......| 
Zfish   102 ------TQQEATLAQYPD---------------CKSSNSTN---PGEGQGHLSQNSSPSLMFPWM 142

  Fly   298 ---------SRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHT 353
                     .|..:|..|...||.:|....|:|:..|.:::..|:||:.|||:|||||||||:  
Zfish   143 RPHAPGRRNGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALSLTERQVKIWFQNRRMKWK-- 205

  Fly   354 RENLKS---GQEKQPSAVPESGGVFKTSTPSGDGTPQEALDYSSD 395
            :||.|.   ||..:..|..|..|       :.||..:|..|..::
Zfish   206 KENNKDKFPGQRGEAEAEAEEEG-------NEDGEAEEGEDKETE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 23/52 (44%)
hoxc8aNP_001005771.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..152 10/57 (18%)
Antp-type hexapeptide. /evidence=ECO:0000255 138..143 1/4 (25%)
Homeobox 153..205 CDD:278475 23/51 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..250 12/45 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.