DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and hoxc8

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001006787.1 Gene:hoxc8 / 448482 XenbaseID:XB-GENE-480999 Length:242 Species:Xenopus tropicalis


Alignment Length:266 Identity:67/266 - (25%)
Similarity:95/266 - (35%) Gaps:94/266 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 RAAEHAAPTYPTLATNALLRFHQHQKQQHQ------------QHHHHQHHPKHLHQQHKPPPHNS 220
            :..|...|||..      .||.|...:.|.            ||..| |..:..|          
 Frog    14 KGGESLEPTYYD------CRFPQSVSRSHALVYGPSATAPGFQHPSH-HVQEFFH---------- 61

  Fly   221 TTASALLAPLHSLTSLQLTQQQQ------------RFLG--KTPQQLLDIA---------PTSPA 262
                      |..:||..:..||            :|.|  ..|:|.|..|         |...:
 Frog    62 ----------HGSSSLSNSGFQQNPCALTCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKS 116

  Fly   263 AAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSW----------SRAVFSNLQRKGLEIQFQQQ 317
            ::...||:          |||:.:..|:......|          .|..:|..|...||.:|...
 Frog   117 SSNTNTSE----------GQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLFN 171

  Fly   318 KYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPESGGVFKTSTPSG 382
            .|:|:..|.:::..|.||:.|||:|||||||||:  :||.|   :|.|.|..|.    ||..   
 Frog   172 PYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWK--KENNK---DKLPGARDEE----KTEE--- 224

  Fly   383 DGTPQE 388
            :|..:|
 Frog   225 EGNEEE 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 23/52 (44%)
hoxc8NP_001006787.1 Homeobox 153..206 CDD:365835 24/54 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.